TG001010

From GPTWiki
Jump to navigation Jump to search
Peptide K.YLGN[H5N4S]ATAIFFLPDEGKLQHLENELTHDIITK.F (PE000220)
Sequence YLGNATAIFFLPDEGKLQHLENELTHDIITK
Glycans(s) H5N4S (N4)
Mod(s)
Molecular Weight 5,471.518
Charge 5+
Protein SERPINA1 (P01009)
Spectrum File MS_35_Frac_plasma_run02_fr17
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
64.762 65.054 134.895 1,091.709 5+ 1,478.390 3+ Y[pH3N2] 30.8
64.762 65.054 134.895 1,091.709 5+ 1,424.373 3+ Y[pH2N2] 29.1
64.762 65.054 134.895 1,091.709 5+ 1,248.644 3+ Y[pN] 18.1
64.762 65.054 134.895 1,091.709 5+ 1,600.101 3+ Y[pH4N3] 12.3
64.762 65.054 134.895 1,091.709 5+ 1,370.355 3+ Y[pHN2] 10.9
64.762 65.054 134.895 1,091.709 5+ 1,872.463 2+ Y[pN] 9.5
64.762 65.054 134.895 1,091.709 5+ 1,546.083 3+ Y[pH3N3] 8.8
64.762 65.054 134.895 1,091.709 5+ 1,316.337 3+ Y[pN2] 7.9

Spectra

15953;EThcD;64.730;15945;1091.705;Byonic:q-value=7.99e-10/GPS:MinICScore=8.172
15955;HCD;64.735;15945;1091.705;