TG000998

From GPTWiki
Jump to navigation Jump to search
Peptide K.YLGN[H5N4S2]ATAIFFLPDEGKLQHLENELTHDIITK.F (PE000247)
Sequence YLGNATAIFFLPDEGKLQHLENELTHDIITK
Glycans(s) H5N4S2 (N4)
Mod(s)
Molecular Weight 5,762.613
Charge 4+
Protein SERPINA1 (P01009)
Spectrum File MS_35_Frac_plasma_run02_fr17
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
69.770 70.159 148.160 1,437.158 4+ 1,600.101 3+ Y[pH4N3] 30.2
69.770 70.159 148.160 1,437.158 4+ 1,364.385 4+ Y[pH5N4S] 20.2
69.770 70.159 148.160 1,437.158 4+ 1,546.083 3+ Y[pH3N3] 16.9
69.770 70.159 148.160 1,437.158 4+ 1,697.133 3+ Y[pH4N3S] 11.2
69.770 70.159 148.160 1,437.158 4+ 1,872.463 2+ Y[pN] 7.8
69.770 70.159 148.160 1,437.158 4+ 1,248.644 3+ Y[pN] 6.4
69.770 70.159 148.160 1,437.158 4+ 1,424.373 3+ Y[pH2N2] 5.8
69.770 70.159 148.160 1,437.158 4+ 1,643.115 3+ Y[pH3N3S] 5.2

Spectra

17229;EThcD;69.762;17227;1437.156;Byonic:q-value=0.000157/GPS:MinICScore=16.673
17231;HCD;69.770;17227;1437.156;