TG000934

From GPTWiki
Jump to navigation Jump to search
Peptide R.LEPVHLQLQCMSQEQLAQVAAN[H5N4S2]ATKEFTEAFLGCPAIHPR.C (PE000236)
Sequence LEPVHLQLQCMSQEQLAQVAANATKEFTEAFLGCPAIHPR
Glycans(s) H5N4S2 (N22)
Mod(s) 57.021 (C10), 57.021 (C34)
Molecular Weight 6,755.023
Charge 6+
Protein PGLYRP2 (Q96PD5)
Spectrum File MS_35_Frac_plasma_run02_fr14
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
76.733 1,123.847 6+ 1,316.640 4+ Y[pH2N2] 67.3
76.733 1,123.847 6+ 1,357.153 4+ Y[pH3N2] 61.3
76.733 1,123.847 6+ 1,448.437 4+ Y[pH4N3] 40.4
76.733 1,123.847 6+ 1,407.923 4+ Y[pH3N3] 37.8
76.733 1,123.847 6+ 1,184.844 4+ Y[pN] 33.8
76.733 1,123.847 6+ 1,579.456 3+ Y[pN] 20.7
76.733 1,123.847 6+ 1,235.614 4+ Y[pN2] 18.6
76.733 1,123.847 6+ 1,276.127 4+ Y[pHN2] 15.4
76.733 1,123.847 6+ 1,367.410 4+ Y[pH2N3] 7.1
76.733 1,123.847 6+ 1,755.184 3+ Y[pH2N2] 7.0
76.733 1,123.847 6+ 1,809.202 3+ Y[pH3N2] 6.1
76.733 1,123.847 6+ 1,499.206 4+ Y[pH4N4] 5.9
76.733 1,123.847 6+ 948.077 5+ Y[pN] 5.3

Spectra

17179;EThcD;76.725;17178;1123.839;Byonic:q-value=0.0036/GPS:MinICScore=764.397
17181;HCD;76.733;17178;1123.839;