TG000856

From GPTWiki
Jump to navigation Jump to search
Peptide R.NQALN[H5N4S2]LSLAYSFVTPLTSMVVTKPDDQEQSQVAEKPM[Ox]EGESR.N (PE000438)
Sequence NQALNLSLAYSFVTPLTSMVVTKPDDQEQSQVAEKPMEGESR
Glycans(s) H5N4S2 (N5)
Mod(s) 15.995 (M37)
Molecular Weight 6,876.041
Charge 5+
Protein ITIH4 (Q14624)
Spectrum File MS_35_Frac_plasma_run02_fr12
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
66.828 67.052 138.223 1,372.614 5+ 1,619.787 3+ Y[pN] 41.9
66.828 67.052 138.223 1,372.614 5+ 1,849.533 3+ Y[pH3N2] 28.8
66.828 67.052 138.223 1,372.614 5+ 1,795.515 3+ Y[pH2N2] 27.8
66.828 67.052 138.223 1,372.614 5+ 1,552.094 3+ Y[p] 23.8
66.828 67.052 138.223 1,372.614 5+ 1,215.092 4+ Y[pN] 11.2
66.828 67.052 138.223 1,372.614 5+ 1,741.498 3+ Y[pHN2] 10.4
66.828 67.052 138.223 1,372.614 5+ 1,438.171 4+ Y[pH3N3] 10.0
66.828 67.052 138.223 1,372.614 5+ 1,687.480 3+ Y[pN2] 6.3
66.828 67.052 138.223 1,372.614 5+ 1,971.244 3+ Y[pH4N3] 5.5
66.828 67.052 138.223 1,372.614 5+ 1,917.226 3+ Y[pH3N3] 5.4
66.828 67.052 138.223 1,372.614 5+ 1,642.742 4+ Y[pH5N4S] 5.2

Spectra

16207;EThcD;66.822;16202;1372.818;Byonic:q-value=0.00308/GPS:MinICScore=1789.926
16209;HCD;66.828;16202;1372.818;