TG000848

From GPTWiki
Jump to navigation Jump to search
Peptide K.YLGN[H5N4S2]ATAIFFLPDEGKLQHLENELTHDIITK.F (PE000247)
Sequence YLGNATAIFFLPDEGKLQHLENELTHDIITK
Glycans(s) H5N4S2 (N4)
Mod(s)
Molecular Weight 5,762.613
Charge 4+
Protein SERPINA1 (P01009)
Spectrum File MS_35_Frac_plasma_run02_fr12
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
70.152 70.084 145.884 1,437.158 4+ 1,600.101 3+ Y[pH4N3] 69.1
70.152 70.084 145.884 1,437.158 4+ 1,364.385 4+ Y[pH5N4S] 53.6
70.152 70.084 145.884 1,437.158 4+ 1,546.083 3+ Y[pH3N3] 32.9
70.152 70.084 145.884 1,437.158 4+ 1,697.133 3+ Y[pH4N3S] 27.6
70.152 70.084 145.884 1,437.158 4+ 1,248.644 3+ Y[pN] 13.0
70.152 70.084 145.884 1,437.158 4+ 1,424.373 3+ Y[pH2N2] 11.7
70.152 70.084 145.884 1,437.158 4+ 1,291.611 4+ Y[pH5N4] 10.7
70.152 70.084 145.884 1,437.158 4+ 1,721.812 3+ Y[pH5N4] 9.2
70.152 70.084 145.884 1,437.158 4+ 1,643.115 3+ Y[pH3N3S] 8.9
70.152 70.084 145.884 1,437.158 4+ 1,478.390 3+ Y[pH3N2] 8.8
70.152 70.084 145.884 1,437.158 4+ 1,872.463 2+ Y[pN] 8.3
70.152 70.084 145.884 1,437.158 4+ 1,316.337 3+ Y[pN2] 6.4
70.152 70.084 145.884 1,437.158 4+ 1,370.355 3+ Y[pHN2] 5.0

Spectra

17176;EThcD;70.146;17165;1437.153;Byonic:q-value=1.15e-07/GPS:MinICScore=7.977
17178;HCD;70.152;17165;1437.153;
17202;EThcD;70.236;17197;1437.654;Byonic:q-value=0.00171/GPS:MinICScore=8.486
17204;HCD;70.242;17197;1437.654;