TG000789

From GPTWiki
Jump to navigation Jump to search
Peptide K.YTGN[H6N5FS3]ASALFILPDQDKMEEVEAMLLPETLKR.W (PE000082)
Sequence YTGNASALFILPDQDKMEEVEAMLLPETLKR
Glycans(s) H6N5FS3 (N4)
Mod(s)
Molecular Weight 6,546.847
Charge 4+
Protein SERPINA3 (P01011)
Spectrum File MS_35_Frac_plasma_run02_fr11
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
78.225 78.252 167.472 1,633.217 4+ 1,560.443 4+ Y[pH6N5FS2] 65.7
78.225 78.252 167.472 1,633.217 4+ 1,540.066 3+ Y[pH3N3] 24.3
78.225 78.252 167.472 1,633.217 4+ 1,715.795 3+ Y[pH5N4] 24.1
78.225 78.252 167.472 1,633.217 4+ 1,487.669 4+ Y[pH6N5FS] 21.4
78.225 78.252 167.472 1,633.217 4+ 1,812.826 3+ Y[pH5N4S] 14.5
78.225 78.252 167.472 1,633.217 4+ 1,242.627 3+ Y[pN] 14.4
78.225 78.252 167.472 1,633.217 4+ 1,764.481 3+ Y[pH5N4F] 12.5
78.225 78.252 167.472 1,633.217 4+ 1,861.512 3+ Y[pH5N4FS] 12.1
78.225 78.252 167.472 1,633.217 4+ 1,596.702 4+ Y[pH6N5S3] 11.1
78.225 78.252 167.472 1,633.217 4+ 1,637.098 3+ Y[pH3N3S] 10.5
78.225 78.252 167.472 1,633.217 4+ 1,909.858 3+ Y[pH5N4S2] 7.9
78.225 78.252 167.472 1,633.217 4+ 1,451.155 4+ Y[pH6N5S] 6.7
78.225 78.252 167.472 1,633.217 4+ 1,958.544 3+ Y[pH5N4FS2] 6.3
78.225 78.252 167.472 1,633.217 4+ 1,661.777 3+ Y[pH4N4] 5.9
78.225 78.252 167.472 1,633.217 4+ 1,594.084 3+ Y[pH4N3] 5.5

Spectra

19814;EThcD;78.232;19802;1633.211;Byonic:q-value=4.47e-05/GPS:MinICScore=20.096
19816;HCD;78.238;19802;1633.211;