TG000788

From GPTWiki
Jump to navigation Jump to search
Peptide K.YLGN[H5N4S]ATAIFFLPDEGKLQHLENELTHDIITK.F (PE000220)
Sequence YLGNATAIFFLPDEGKLQHLENELTHDIITK
Glycans(s) H5N4S (N4)
Mod(s)
Molecular Weight 5,471.518
Charge 5+
Protein SERPINA1 (P01009)
Spectrum File MS_35_Frac_plasma_run02_fr11
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
65.305 65.365 134.752 1,091.709 5+ 1,478.390 3+ Y[pH3N2] 38.4
65.305 65.365 134.752 1,091.709 5+ 1,424.373 3+ Y[pH2N2] 36.9
65.305 65.365 134.752 1,091.709 5+ 1,248.644 3+ Y[pN] 24.4
65.305 65.365 134.752 1,091.709 5+ 1,370.355 3+ Y[pHN2] 13.0
65.305 65.365 134.752 1,091.709 5+ 1,872.463 2+ Y[pN] 11.7
65.305 65.365 134.752 1,091.709 5+ 1,600.101 3+ Y[pH4N3] 10.8
65.305 65.365 134.752 1,091.709 5+ 1,316.337 3+ Y[pN2] 9.6
65.305 65.365 134.752 1,091.709 5+ 1,546.083 3+ Y[pH3N3] 7.6
65.305 65.365 134.752 1,091.709 5+ 1,200.328 4+ Y[pH4N3] 5.8
65.305 65.365 134.752 1,091.709 5+ 1,159.814 4+ Y[pH3N3] 5.3

Spectra

16149;EThcD;65.076;16147;1091.704;Byonic:q-value=3.74e-12/GPS:MinICScore=9.729
16151;HCD;65.083;16147;1091.704;
16269;EThcD;65.518;16263;1091.705;Byonic:q-value=1.27e-10/GPS:MinICScore=9.726
16271;HCD;65.523;16263;1091.705;