TG000784

From GPTWiki
Jump to navigation Jump to search
Peptide K.YLGN[H6N5FS3]ATAIFFLPDEGKLQHLENELTHDIITK.F (PE000073)
Sequence YLGNATAIFFLPDEGKLQHLENELTHDIITK
Glycans(s) H6N5FS3 (N4)
Mod(s)
Molecular Weight 6,564.899
Charge 5+
Protein SERPINA1 (P01009)
Spectrum File MS_35_Frac_plasma_run02_fr11
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
75.243 75.376 160.170 1,310.385 5+ 1,600.101 3+ Y[pH4N3] 25.0
75.243 75.376 160.170 1,310.385 5+ 1,424.373 3+ Y[pH2N2] 24.5
75.243 75.376 160.170 1,310.385 5+ 1,546.083 3+ Y[pH3N3] 20.8
75.243 75.376 160.170 1,310.385 5+ 1,248.644 3+ Y[pN] 15.4
75.243 75.376 160.170 1,310.385 5+ 1,370.355 3+ Y[pHN2] 9.9
75.243 75.376 160.170 1,310.385 5+ 1,872.463 2+ Y[pN] 8.6
75.243 75.376 160.170 1,310.385 5+ 1,721.812 3+ Y[pH5N4] 7.7
75.243 75.376 160.170 1,310.385 5+ 1,667.794 3+ Y[pH4N4] 6.6
75.243 75.376 160.170 1,310.385 5+ 1,492.066 3+ Y[pH2N3] 6.6
75.243 75.376 160.170 1,310.385 5+ 1,364.385 4+ Y[pH5N4S] 6.5
75.243 75.376 160.170 1,310.385 5+ 1,697.133 3+ Y[pH4N3S] 6.5
75.243 75.376 160.170 1,310.385 5+ 1,316.337 3+ Y[pN2] 5.3
75.243 75.376 160.170 1,310.385 5+ 1,473.059 3+ Y[pH2N2F]* 5.2
75.243 75.376 160.170 1,310.385 5+ 1,473.673 4+ Y[pH5N4FS2] 5.2
75.243 75.376 160.170 1,310.385 5+ 1,478.390 3+ Y[pH3N2] 5.1
75.243 75.376 160.170 1,310.385 5+ 1,437.158 4+ Y[pH5N4S2] 5.0

Spectra

18995;EThcD;75.235;18993;1310.381;Byonic:q-value=4.47e-05/GPS:MinICScore=54.144
18997;HCD;75.243;18993;1310.381;