TG000782

From GPTWiki
Jump to navigation Jump to search
Peptide K.IVLDPSGSMNIYLVLDGSDSIGASN[H5N4S2]FTGAK.K (PE000102)
Sequence IVLDPSGSMNIYLVLDGSDSIGASNFTGAK
Glycans(s) H5N4S2 (N25)
Mod(s)
Molecular Weight 5,263.289
Charge 4+
Protein CFB (P00751)
Spectrum File MS_35_Frac_plasma_run02_fr11
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
79.651 1,312.328 4+ 1,622.801 2+ Y[pN] 44.6
79.651 1,312.328 4+ 1,886.393 2+ Y[pH2N2] 15.5
79.651 1,312.328 4+ 1,967.420 2+ Y[pH3N2] 14.4
79.651 1,312.328 4+ 1,805.367 2+ Y[pHN2] 5.8
79.651 1,312.328 4+ 1,724.340 2+ Y[pN2] 5.2

Spectra

20078;EThcD;79.241;20073;1312.573;Byonic:q-value=4.47e-05/GPS:MinICScore=14.805
20080;HCD;79.247;20073;1312.573;
20295;EThcD;80.048;20293;1312.575;Byonic:q-value=0.00587/GPS:MinICScore=32.743
20297;HCD;80.054;20293;1312.575;