TG000756

From GPTWiki
Jump to navigation Jump to search
Peptide K.NCGVN[H5N4S2]CSGDVFTALIGEIASPNYPKPYPENSR.C (PE000189)
Sequence NCGVNCSGDVFTALIGEIASPNYPKPYPENSR
Glycans(s) H5N4S2 (N5)
Mod(s) 57.021 (C2), 57.021 (C6)
Molecular Weight 5,748.412
Charge 4+
Protein C1S (P09871)
Spectrum File MS_35_Frac_plasma_run02_fr11
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
67.752 67.654 140.563 1,433.615 4+ 1,692.408 3+ Y[pH4N3S] 25.1
67.752 67.654 140.563 1,433.615 4+ 1,595.376 3+ Y[pH4N3] 23.1
67.752 67.654 140.563 1,433.615 4+ 1,541.358 3+ Y[pH3N3] 13.3
67.752 67.654 140.563 1,433.615 4+ 1,865.375 2+ Y[pN] 12.5
67.752 67.654 140.563 1,433.615 4+ 1,243.919 3+ Y[pN] 10.7
67.752 67.654 140.563 1,433.615 4+ 1,638.390 3+ Y[pH3N3S] 9.2
67.752 67.654 140.563 1,433.615 4+ 1,814.118 3+ Y[pH5N4S] 5.2

Spectra

16915;EThcD;67.746;16902;1433.602;Byonic:q-value=2.2e-10/GPS:MinICScore=10.568
16917;HCD;67.752;16902;1433.602;
17083;EThcD;68.331;17073;1433.854;Byonic:q-value=1.7e-08/GPS:MinICScore=67.959
17085;HCD;68.337;17073;1433.854;