TG000745

From GPTWiki
Jump to navigation Jump to search
Peptide K.YLGN[H5N4FS2]ATAIFFLPDEGKLQHLENELTHDIITK.F (PE000254)
Sequence YLGNATAIFFLPDEGKLQHLENELTHDIITK
Glycans(s) H5N4FS2 (N4)
Mod(s)
Molecular Weight 5,908.671
Charge 5+
Protein SERPINA1 (P01009)
Spectrum File MS_35_Frac_plasma_run02_fr11
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
70.303 70.070 146.698 1,179.140 5+ 1,478.390 3+ Y[pH3N2] 52.1
70.303 70.070 146.698 1,179.140 5+ 1,424.373 3+ Y[pH2N2] 44.5
70.303 70.070 146.698 1,179.140 5+ 1,248.644 3+ Y[pN] 27.1
70.303 70.070 146.698 1,179.140 5+ 1,600.101 3+ Y[pH4N3] 16.1
70.303 70.070 146.698 1,179.140 5+ 1,527.076 3+ Y[pH3N2F]* 13.5
70.303 70.070 146.698 1,179.140 5+ 1,546.083 3+ Y[pH3N3] 13.1
70.303 70.070 146.698 1,179.140 5+ 1,370.355 3+ Y[pHN2] 13.0
70.303 70.070 146.698 1,179.140 5+ 1,872.463 2+ Y[pN] 12.0
70.303 70.070 146.698 1,179.140 5+ 1,316.337 3+ Y[pN2] 9.8
70.303 70.070 146.698 1,179.140 5+ 1,473.059 3+ Y[pH2N2F]* 7.5
70.303 70.070 146.698 1,179.140 5+ 1,473.673 4+ Y[pH5N4FS2] 7.5
70.303 70.070 146.698 1,179.140 5+ 1,648.787 3+ Y[pH4N3F] 7.1
70.303 70.070 146.698 1,179.140 5+ 1,159.814 4+ Y[pH3N3] 5.9

Spectra

17543;EThcD;69.981;17531;1179.135;Byonic:q-value=7.92e-09/GPS:MinICScore=12.894
17545;HCD;69.989;17531;1179.135;
17721;EThcD;70.612;17715;1179.534;Byonic:q-value=0.000157/GPS:MinICScore=21.243
17723;HCD;70.618;17715;1179.534;