TG000737

From GPTWiki
Jump to navigation Jump to search
Peptide K.YTGN[H6N5FS3]ASALFILPDQDKMEEVEAMLLPETLKR.W (PE000082)
Sequence YTGNASALFILPDQDKMEEVEAMLLPETLKR
Glycans(s) H6N5FS3 (N4)
Mod(s)
Molecular Weight 6,546.847
Charge 5+
Protein SERPINA3 (P01011)
Spectrum File MS_35_Frac_plasma_run02_fr11
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
78.225 78.224 167.401 1,306.775 5+ 1,418.355 3+ Y[pH2N2] 21.2
78.225 78.224 167.401 1,306.775 5+ 1,594.084 3+ Y[pH4N3] 20.6
78.225 78.224 167.401 1,306.775 5+ 1,540.066 3+ Y[pH3N3] 16.1
78.225 78.224 167.401 1,306.775 5+ 1,242.627 3+ Y[pN] 14.2
78.225 78.224 167.401 1,306.775 5+ 1,242.586 4+ Y[pH3N4F] 13.6
78.225 78.224 167.401 1,306.775 5+ 1,364.338 3+ Y[pHN2] 8.2
78.225 78.224 167.401 1,306.775 5+ 1,863.437 2+ Y[pN] 7.1
78.225 78.224 167.401 1,306.775 5+ 1,691.116 3+ Y[pH4N3S] 6.6
78.225 78.224 167.401 1,306.775 5+ 1,310.320 3+ Y[pN2] 6.0
78.225 78.224 167.401 1,306.775 5+ 1,715.795 3+ Y[pH5N4] 5.5
78.225 78.224 167.401 1,306.775 5+ 1,661.777 3+ Y[pH4N4] 5.2
78.225 78.224 167.401 1,306.775 5+ 1,642.770 3+ Y[pH4N3F] 5.1

Spectra

19807;EThcD;78.208;19802;1306.770;Byonic:q-value=2.3e-07/GPS:MinICScore=19.151
19809;HCD;78.213;19802;1306.770;