TG000704

From GPTWiki
Jump to navigation Jump to search
Peptide K.YLGN[H6N5S3]ATAIFFLPDEGKLQHLENELTHDIITK.F (PE000260)
Sequence YLGNATAIFFLPDEGKLQHLENELTHDIITK
Glycans(s) H6N5S3 (N4)
Mod(s)
Molecular Weight 6,418.841
Charge 5+
Protein SERPINA1 (P01009)
Spectrum File MS_35_Frac_plasma_run02_fr11
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
75.532 75.444 160.343 1,281.174 5+ 1,600.101 3+ Y[pH4N3] 29.3
75.532 75.444 160.343 1,281.174 5+ 1,424.373 3+ Y[pH2N2] 24.5
75.532 75.444 160.343 1,281.174 5+ 1,546.083 3+ Y[pH3N3] 20.8
75.532 75.444 160.343 1,281.174 5+ 1,601.215 4+ Y[pH6N5S3] 19.8
75.532 75.444 160.343 1,281.174 5+ 1,364.385 4+ Y[pH5N4S] 14.6
75.532 75.444 160.343 1,281.174 5+ 1,248.644 3+ Y[pN] 13.2
75.532 75.444 160.343 1,281.174 5+ 1,437.158 4+ Y[pH5N4S2] 10.9
75.532 75.444 160.343 1,281.174 5+ 1,370.355 3+ Y[pHN2] 10.2
75.532 75.444 160.343 1,281.174 5+ 1,697.133 3+ Y[pH4N3S] 9.7
75.532 75.444 160.343 1,281.174 5+ 1,872.463 2+ Y[pN] 9.4
75.532 75.444 160.343 1,281.174 5+ 1,721.812 3+ Y[pH5N4] 9.0
75.532 75.444 160.343 1,281.174 5+ 1,455.668 4+ Y[pH6N5S] 6.7
75.532 75.444 160.343 1,281.174 5+ 1,316.337 3+ Y[pN2] 6.0
75.532 75.444 160.343 1,281.174 5+ 1,478.390 3+ Y[pH3N2] 5.9
75.532 75.444 160.343 1,281.174 5+ 1,667.794 3+ Y[pH4N4] 5.9

Spectra

19075;EThcD;75.526;19068;1281.168;Byonic:q-value=4.47e-05/GPS:MinICScore=56.430
19077;HCD;75.532;19068;1281.168;