TG000695

From GPTWiki
Jump to navigation Jump to search
Peptide K.YTGN[H5N4S2]ASALFILPDQDKMEEVEAMLLPETLK.R (PE000077)
Sequence YTGNASALFILPDQDKMEEVEAMLLPETLK
Glycans(s) H5N4S2 (N4)
Mod(s)
Molecular Weight 5,588.46
Charge 4+
Protein SERPINA3 (P01011)
Spectrum File MS_35_Frac_plasma_run02_fr10
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
80.483 80.419 172.752 1,393.620 4+ 1,785.386 2+ Y[pN] 30.3
80.483 80.419 172.752 1,393.620 4+ 1,542.050 3+ Y[pH4N3] 23.2
80.483 80.419 172.752 1,393.620 4+ 1,639.082 3+ Y[pH4N3S] 23.0
80.483 80.419 172.752 1,393.620 4+ 1,488.033 3+ Y[pH3N3] 12.3
80.483 80.419 172.752 1,393.620 4+ 1,585.064 3+ Y[pH3N3S] 7.7
80.483 80.419 172.752 1,393.620 4+ 1,760.793 3+ Y[pH5N4S] 6.8
80.483 80.419 172.752 1,393.620 4+ 1,663.761 3+ Y[pH5N4] 5.7
80.483 80.419 172.752 1,393.620 4+ 1,967.952 2+ Y[pHN2] 5.2

Spectra

20036;EThcD;80.478;20031;1393.614;Byonic:q-value=1.36e-07/GPS:MinICScore=215.203
20037;HCD;80.483;20031;1393.614;