TG000683

From GPTWiki
Jump to navigation Jump to search
Peptide R.FSLLGHASISCTVEN[H6N5S3]ETIGVWRPSPPTCEK.I (PE000129)
Sequence FSLLGHASISCTVENETIGVWRPSPPTCEK
Glycans(s) H6N5S3 (N15)
Mod(s) 57.021 (C11), 57.021 (C28)
Molecular Weight 6,250.638
Charge 5+
Protein C4BPA (P04003)
Spectrum File MS_35_Frac_plasma_run02_fr10
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
54.802 54.864 108.026 1,247.538 5+ 1,192.585 3+ Y[pN] 13.5
54.802 54.864 108.026 1,247.538 5+ 1,249.566 4+ Y[pH5N4] 7.4
54.802 54.864 108.026 1,247.538 5+ 1,544.042 3+ Y[pH4N3] 6.6
54.802 54.864 108.026 1,247.538 5+ 1,490.024 3+ Y[pH3N3] 5.9

Spectra

12977;EThcD;54.677;12972;1247.930;Byonic:q-value=2.66e-07/GPS:MinICScore=519.275
12979;HCD;54.682;12972;1247.930;
13011;EThcD;54.795;13002;1247.728;Byonic:q-value=1.02e-07/GPS:MinICScore=283.409
13013;HCD;54.802;13002;1247.728;