TG000677

From GPTWiki
Jump to navigation Jump to search
Peptide K.YTGN[H6N5FS3]ASALFILPDQDKMEEVEAMLLPETLKR.W (PE000082)
Sequence YTGNASALFILPDQDKMEEVEAMLLPETLKR
Glycans(s) H6N5FS3 (N4)
Mod(s)
Molecular Weight 6,546.847
Charge 5+
Protein SERPINA3 (P01011)
Spectrum File MS_35_Frac_plasma_run02_fr10
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
78.509 78.330 167.461 1,306.775 5+ 1,594.084 3+ Y[pH4N3] 29.6
78.509 78.330 167.461 1,306.775 5+ 1,418.355 3+ Y[pH2N2] 26.4
78.509 78.330 167.461 1,306.775 5+ 1,540.066 3+ Y[pH3N3] 21.9
78.509 78.330 167.461 1,306.775 5+ 1,242.627 3+ Y[pN] 15.1
78.509 78.330 167.461 1,306.775 5+ 1,364.338 3+ Y[pHN2] 11.8
78.509 78.330 167.461 1,306.775 5+ 1,691.116 3+ Y[pH4N3S] 10.9
78.509 78.330 167.461 1,306.775 5+ 1,359.872 4+ Y[pH5N4S] 8.6
78.509 78.330 167.461 1,306.775 5+ 1,359.006 3+ Y[pN2F]* 8.3
78.509 78.330 167.461 1,306.775 5+ 1,642.770 3+ Y[pH4N3F] 7.8
78.509 78.330 167.461 1,306.775 5+ 1,310.320 3+ Y[pN2] 7.4
78.509 78.330 167.461 1,306.775 5+ 1,715.795 3+ Y[pH5N4] 7.1
78.509 78.330 167.461 1,306.775 5+ 1,472.373 3+ Y[pH3N2] 6.5
78.509 78.330 167.461 1,306.775 5+ 1,396.386 4+ Y[pH5N4FS] 6.5
78.509 78.330 167.461 1,306.775 5+ 1,228.075 4+ Y[pH3N3S] 6.4
78.509 78.330 167.461 1,306.775 5+ 1,661.777 3+ Y[pH4N4] 6.1
78.509 78.330 167.461 1,306.775 5+ 1,432.646 4+ Y[pH5N4S2] 6.0
78.509 78.330 167.461 1,306.775 5+ 1,863.437 2+ Y[pN] 5.7
78.509 78.330 167.461 1,306.775 5+ 1,637.098 3+ Y[pH3N3S] 5.6
78.509 78.330 167.461 1,306.775 5+ 1,469.160 4+ Y[pH5N4FS2] 5.5

Spectra

19532;EThcD;78.501;19525;1306.770;Byonic:q-value=0.00184/GPS:MinICScore=26.633
19534;HCD;78.509;19525;1306.770;