TG000643

From GPTWiki
Jump to navigation Jump to search
Peptide R.FSLLGHASISCTVEN[H6N5S3]ETIGVWRPSPPTCEK.I (PE000129)
Sequence FSLLGHASISCTVENETIGVWRPSPPTCEK
Glycans(s) H6N5S3 (N15)
Mod(s) 57.021 (C11), 57.021 (C28)
Molecular Weight 6,250.638
Charge 4+
Protein C4BPA (P04003)
Spectrum File MS_35_Frac_plasma_run02_fr10
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
54.802 54.958 108.264 1,559.171 4+ 1,665.753 3+ Y[pH5N4] 34.3
54.802 54.958 108.264 1,559.171 4+ 1,762.784 3+ Y[pH5N4S] 30.4
54.802 54.958 108.264 1,559.171 4+ 1,486.397 4+ Y[pH6N5S2] 29.4
54.802 54.958 108.264 1,559.171 4+ 1,192.585 3+ Y[pN] 27.4
54.802 54.958 108.264 1,559.171 4+ 1,490.024 3+ Y[pH3N3] 25.6
54.802 54.958 108.264 1,559.171 4+ 1,587.056 3+ Y[pH3N3S] 16.4
54.802 54.958 108.264 1,559.171 4+ 1,413.623 4+ Y[pH6N5S] 14.1
54.802 54.958 108.264 1,559.171 4+ 1,611.735 3+ Y[pH4N4] 10.6
54.802 54.958 108.264 1,559.171 4+ 1,544.042 3+ Y[pH4N3] 8.3
54.802 54.958 108.264 1,559.171 4+ 1,788.374 2+ Y[pN] 7.2
54.802 54.958 108.264 1,559.171 4+ 1,260.278 3+ Y[pN2] 5.9
54.802 54.958 108.264 1,559.171 4+ 1,557.717 3+ Y[pH3N4] 5.4
54.802 54.958 108.264 1,559.171 4+ 1,884.495 3+ Y[pH6N5S] 5.1
54.802 54.958 108.264 1,559.171 4+ 1,708.767 3+ Y[pH4N4S] 5.1

Spectra

13102;EThcD;55.104;13100;1559.405;Byonic:q-value=7.29e-09/GPS:MinICScore=16.670
13104;HCD;55.111;13100;1559.405;