TG000631

From GPTWiki
Jump to navigation Jump to search
Peptide R.FSLLGHASISCTVEN[H5N4S2]ETIGVWRPSPPTCEK.I (PE000134)
Sequence FSLLGHASISCTVENETIGVWRPSPPTCEK
Glycans(s) H5N4S2 (N15)
Mod(s) 57.021 (C11), 57.021 (C28)
Molecular Weight 5,594.411
Charge 4+
Protein C4BPA (P04003)
Spectrum File MS_35_Frac_plasma_run01_fr10_01
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
49.433 49.482 94.404 1,395.114 4+ 1,544.042 3+ Y[pH4N3] 57.0
49.433 49.482 94.404 1,395.114 4+ 1,192.585 3+ Y[pN] 33.3
49.433 49.482 94.404 1,395.114 4+ 1,490.024 3+ Y[pH3N3] 31.7
49.433 49.482 94.404 1,395.114 4+ 1,322.340 4+ Y[pH5N4S] 19.5
49.433 49.482 94.404 1,395.114 4+ 1,665.753 3+ Y[pH5N4] 11.4
49.433 49.482 94.404 1,395.114 4+ 1,368.314 3+ Y[pH2N2] 8.9
49.433 49.482 94.404 1,395.114 4+ 1,788.374 2+ Y[pN] 7.4
49.433 49.482 94.404 1,395.114 4+ 1,762.784 3+ Y[pH5N4S] 6.7
49.433 49.482 94.404 1,395.114 4+ 1,422.331 3+ Y[pH3N2] 6.4
49.433 49.482 94.404 1,395.114 4+ 1,249.566 4+ Y[pH5N4] 6.1
49.433 49.482 94.404 1,395.114 4+ 1,260.278 3+ Y[pN2] 5.5

Spectra

11505;EThcD;49.242;11497;1395.349;Byonic:q-value=6.17e-09/GPS:MinICScore=9.737
11507;HCD;49.248;11497;1395.349;
11567;EThcD;49.451;11557;1395.104;Byonic:q-value=9.71e-13/GPS:MinICScore=8.919
11569;HCD;49.457;11557;1395.104;