TG000627

From GPTWiki
Jump to navigation Jump to search
Peptide K.YTGN[H6N5FS3]ASALFILPDQDKMEEVEAMLLPETLK.R (PE000080)
Sequence YTGNASALFILPDQDKMEEVEAMLLPETLK
Glycans(s) H6N5FS3 (N4)
Mod(s)
Molecular Weight 6,390.746
Charge 5+
Protein SERPINA3 (P01011)
Spectrum File MS_35_Frac_plasma_run02_fr10
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
87.809 87.759 191.343 1,275.555 5+ 1,785.386 2+ Y[pN] 22.1
87.809 87.759 191.343 1,275.555 5+ 1,542.050 3+ Y[pH4N3] 9.3
87.809 87.759 191.343 1,275.555 5+ 1,488.033 3+ Y[pH3N3] 8.7
87.809 87.759 191.343 1,275.555 5+ 1,366.322 3+ Y[pH2N2] 7.5
87.809 87.759 191.343 1,275.555 5+ 1,190.593 3+ Y[pN] 7.5
87.809 87.759 191.343 1,275.555 5+ 1,639.082 3+ Y[pH4N3S] 7.4

Spectra

21921;EThcD;87.764;21920;1275.751;Byonic:q-value=0.00818/GPS:MinICScore=31.680
21923;HCD;87.772;21920;1275.751;