TG000624

From GPTWiki
Jump to navigation Jump to search
Peptide K.YTGN[H6N5FS3]ASALFILPDQDKMEEVEAMLLPETLK.R (PE000080)
Sequence YTGNASALFILPDQDKMEEVEAMLLPETLK
Glycans(s) H6N5FS3 (N4)
Mod(s)
Molecular Weight 6,390.746
Charge 4+
Protein SERPINA3 (P01011)
Spectrum File MS_35_Frac_plasma_run02_fr10
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
87.809 87.532 190.768 1,594.192 4+ 1,585.064 3+ Y[pH3N3S] 14.0
87.809 87.532 190.768 1,594.192 4+ 1,760.793 3+ Y[pH5N4S] 12.6
87.809 87.532 190.768 1,594.192 4+ 1,785.386 2+ Y[pN] 12.5
87.809 87.532 190.768 1,594.192 4+ 1,857.824 3+ Y[pH5N4S2] 10.3
87.809 87.532 190.768 1,594.192 4+ 1,809.479 3+ Y[pH5N4FS] 8.1
87.809 87.532 190.768 1,594.192 4+ 1,488.033 3+ Y[pH3N3] 10.3
87.809 87.532 190.768 1,594.192 4+ 1,906.510 3+ Y[pH5N4FS2] 8.3
87.809 87.532 190.768 1,594.192 4+ 1,663.761 3+ Y[pH5N4] 8.0
87.809 87.532 190.768 1,594.192 4+ 1,190.593 3+ Y[pN] 5.9

Spectra

21888;EThcD;87.631;21887;1594.432;Byonic:q-value=1.53e-07/GPS:MinICScore=18.483
21890;HCD;87.639;21887;1594.432;
21938;EThcD;87.838;21935;1594.185;Byonic:q-value=3.89e-10/GPS:MinICScore=20.739
21940;HCD;87.845;21935;1594.185;
21996;EThcD;88.055;21994;1594.685;Byonic:q-value=1.48e-07/GPS:MinICScore=41.132
21998;HCD;88.064;21994;1594.685;