TG000622

From GPTWiki
Jump to navigation Jump to search
Peptide K.YTGN[H6N5S3]ASALFILPDQDKMEEVEAMLLPETLK.R (PE000079)
Sequence YTGNASALFILPDQDKMEEVEAMLLPETLK
Glycans(s) H6N5S3 (N4)
Mod(s)
Molecular Weight 6,244.688
Charge 4+
Protein SERPINA3 (P01011)
Spectrum File MS_35_Frac_plasma_run02_fr10
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
87.877 1,557.677 4+ 1,760.793 3+ Y[pH5N4S] 23.3
87.877 1,557.677 4+ 1,857.824 3+ Y[pH5N4S2] 18.9
87.877 1,557.677 4+ 1,585.064 3+ Y[pH3N3S] 17.3
87.877 1,557.677 4+ 1,488.033 3+ Y[pH3N3] 13.4
87.877 1,557.677 4+ 1,785.386 2+ Y[pN] 12.6
87.877 1,557.677 4+ 1,663.761 3+ Y[pH5N4] 11.9
87.877 1,557.677 4+ 1,190.593 3+ Y[pN] 6.2
87.877 1,557.677 4+ 1,882.503 3+ Y[pH6N5S] 5.8

Spectra

21947;EThcD;87.871;21946;1557.676;Byonic:q-value=7.42e-08/GPS:MinICScore=19.727
21948;HCD;87.877;21946;1557.676;