TG000570

From GPTWiki
Jump to navigation Jump to search
Peptide K.TKPREEQYN[H5N4F]STYRVVSVLTVLHQDWLNGKEYK.C (PE000395)
Sequence TKPREEQYNSTYRVVSVLTVLHQDWLNGKEYK
Glycans(s) H5N4F (N9)
Mod(s)
Molecular Weight 5,666.641
Charge 6+
Protein IGHG1 (P01857)
Spectrum File IgG_Glycopeptide_HCD_V1.E24
Method QExactive, DDA (HCD), Multi-CE
Analytical Fraction
Sample NIST IgG Standard

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
68.826 942.446 6+ 1,190.086 4+ Y[pH2N2F]* 93.6
68.826 942.446 6+ 1,230.599 4+ Y[pH3N2F]* 71.9
68.826 942.446 6+ 1,149.573 4+ Y[pHN2F]* 25.4
68.826 942.446 6+ 1,194.085 4+ Y[pH3N2] 18.4
68.826 942.446 6+ 1,021.775 4+ Y[pN] 16.1
68.826 942.446 6+ 1,057.707 5+ Y[pH4N3F] 13.9
68.826 942.446 6+ 1,153.572 4+ Y[pH2N2] 26.2
68.826 942.446 6+ 1,113.058 4+ Y[pHN2] 11.1
68.826 942.446 6+ 1,240.856 4+ Y[pH2N3F] 9.9
68.826 942.446 6+ 1,058.290 4+ Y[pNF]* 18.8
68.826 942.446 6+ 1,109.060 4+ Y[pN2F]* 7.8
68.826 942.446 6+ 1,244.855 4+ Y[pH3N3] 7.8

Spectra

226;HCD;68.459;;942.442;GPS:MinICScore=100000000000000000000.000
23;HCD;68.854;;942.445;GPS:MinICScore=100000000000000000000.000