TG000500

From GPTWiki
Jump to navigation Jump to search
Peptide R.QLDMLDLSN[H6N5F]NSLASVPEGLWASLGQPNWDM.R (PE000411)
Sequence QLDMLDLSNNSLASVPEGLWASLGQPNWDM
Glycans(s) H6N5F (N9)
Mod(s)
Molecular Weight 5,452.325
Charge 4+
Protein LRG1 (P02750)
Spectrum File MS_24_UO1_IGM_UO1
Method Orbitrap Fusion-Lumos, DDA (HCD pd EThcD), nano LC-MS/MS
Analytical Fraction IGHM Protein Standard
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
25.210 25.265 1,359.587 4+ 1,242.046 4+ Y[pH4N5] 85.0
25.210 25.265 1,359.587 4+ 1,690.735 3+ Y[pH5N4F] 63.5
25.210 25.265 1,359.587 4+ 1,398.628 3+ Y[pH3N2] 44.7
25.210 25.265 1,359.587 4+ 1,344.610 3+ Y[pH2N2] 41.5
25.210 25.265 1,359.587 4+ 1,319.073 4+ Y[pH5N5F] 35.1
25.210 25.265 1,359.587 4+ 1,636.718 3+ Y[pH4N4F] 30.9
25.210 25.265 1,359.587 4+ 1,569.025 3+ Y[pH4N3F] 15.3
25.210 25.265 1,359.587 4+ 1,290.593 3+ Y[pHN2] 8.6
25.210 25.265 1,359.587 4+ 1,278.560 4+ Y[pH4N5F] 7.4
25.210 25.265 1,359.587 4+ 1,515.007 3+ Y[pH3N3F] 6.9
25.210 25.265 1,359.587 4+ 1,447.314 3+ Y[pH3N2F]* 5.2

Spectra

6337;HCD;25.210;6331;1359.842;GPS:FDR=0/GPS:MinICScore=88.911
6339;EThcD;25.213;6331;1359.842;