TG000397

From GPTWiki
Jump to navigation Jump to search
Peptide K.IQCVDGEWTTLPVCIVEESTCGDIPELEHGWAQLSSPPYYYGDSVEFN[H6N5S3]CSESFTMIGHR.S (PE000162)
Sequence IQCVDGEWTTLPVCIVEESTCGDIPELEHGWAQLSSPPYYYGDSVEFNCSESFTMIGHR
Glycans(s) H6N5S3 (N48)
Mod(s) 57.021 (C3), 57.021 (C14), 57.021 (C21), 57.021 (C49)
Molecular Weight 9,731.028
Charge 6+
Protein CFH (P08603)
Spectrum File MS_24_UO1_CFH_UO1
Method Orbitrap Fusion-Lumos, DDA (HCD pd EThcD), nano LC-MS/MS
Analytical Fraction CFH Protein Standard
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
84.555 84.796 1,619.852 6+ 1,764.795 4+ Y[pN] 23.8
84.555 84.796 1,619.852 6+ 1,987.874 4+ Y[pH3N3] 6.8
84.555 84.796 1,619.852 6+ 1,856.078 4+ Y[pHN2] 6.4
84.555 84.796 1,619.852 6+ 1,412.037 5+ Y[pN] 5.9

Spectra

25501;HCD;84.555;25500;1620.171;Byonic:q-value=0.005/GPS:MinICScore=712.892
25502;EThcD;84.561;25500;1620.171;