TG000395

From GPTWiki
Jump to navigation Jump to search
Peptide R.NQALN[H5N4S2]LSLAYSFVTPLTSMVVTKPDDQEQSQVAEKPM[Ox]EGESR.N (PE000438)
Sequence NQALNLSLAYSFVTPLTSMVVTKPDDQEQSQVAEKPMEGESR
Glycans(s) H5N4S2 (N5)
Mod(s) 15.995 (M37)
Molecular Weight 6,876.041
Charge 5+
Protein ITIH4 (Q14624)
Spectrum File MS_35_Frac_plasma_run01_fr10_01
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
66.535 67.380 140.093 1,372.614 5+ 1,619.787 3+ Y[pN] 31.8
66.535 67.380 140.093 1,372.614 5+ 1,552.094 3+ Y[p] 27.9
66.535 67.380 140.093 1,372.614 5+ 1,849.533 3+ Y[pH3N2] 20.6
66.535 67.380 140.093 1,372.614 5+ 1,795.515 3+ Y[pH2N2] 19.8
66.535 67.380 140.093 1,372.614 5+ 1,438.171 4+ Y[pH3N3] 13.4
66.535 67.380 140.093 1,372.614 5+ 1,215.092 4+ Y[pN] 11.5
66.535 67.380 140.093 1,372.614 5+ 1,642.742 4+ Y[pH5N4S] 7.2
66.535 67.380 140.093 1,372.614 5+ 1,569.968 4+ Y[pH5N4] 6.5
66.535 67.380 140.093 1,372.614 5+ 1,741.498 3+ Y[pHN2] 6.1

Spectra

16869;EThcD;66.529;16859;1373.014;Byonic:q-value=0.00467/GPS:MinICScore=212.270
16871;HCD;66.535;16859;1373.014;