TG000376

From GPTWiki
Jump to navigation Jump to search
Peptide -.MGPLMVLFCLLFLYPGLADSAPSCPQNVN[H6N5FS3]ISG.G (PE000403)
Sequence MGPLMVLFCLLFLYPGLADSAPSCPQNVNISG
Glycans(s) H6N5FS3 (N29)
Mod(s) 57.021 (C9), 57.021 (C24)
Molecular Weight 6,505.764
Charge 5+
Protein C2 (P06681)
Spectrum File MS_24_UO1_ACA_UO1
Method Orbitrap Fusion-Lumos, DDA (HCD pd EThcD), nano LC-MS/MS
Analytical Fraction SERPINA3 Protein Standard
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
53.752 1,298.564 5+ 1,509.665 4+ Y[pH5N5FS2] 26.6
53.752 1,298.564 5+ 1,359.864 4+ Y[pH4N5S] 13.8
53.752 1,298.564 5+ 1,396.378 4+ Y[pH4N5FS] 13.6
53.752 1,298.564 5+ 1,296.634 3+ Y[pN2] 10.3
53.752 1,298.564 5+ 1,191.808 4+ Y[pH2N4F]* 10.0
53.752 1,298.564 5+ 1,323.604 4+ Y[pH4N5F] 9.5

Spectra

12956;HCD;53.752;12955;1298.559;GPS:FDR=0/GPS:MinICScore=133.245
12957;EThcD;53.758;12955;1298.559;