TG000369

From GPTWiki
Jump to navigation Jump to search
Peptide K.QLVLKAPDKNVIFSPLSISTALAFLSLGAHN[H5N4S2]TTLTEILK.G (PE000243)
Sequence QLVLKAPDKNVIFSPLSISTALAFLSLGAHNTTLTEILK
Glycans(s) H5N4S2 (N31)
Mod(s)
Molecular Weight 6,386.144
Charge 7+
Protein SERPINA3 (P01011)
Spectrum File MS_31_UO1_MARS_MS2_1ug_longn_CE20_std
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction MARS Depleted
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
74.964 74.928 910.741 7+ 1,092.618 4+ Y[pN] 34.1
74.964 74.928 910.741 7+ 911.314 6+ Y[pH3N4] 31.6
74.964 74.928 910.741 7+ 1,093.375 5+ Y[pH3N4] 26.5
74.964 74.928 910.741 7+ 1,456.488 3+ Y[pN] 22.6
74.964 74.928 910.741 7+ 1,224.414 4+ Y[pH2N2] 18.0
74.964 74.928 910.741 7+ 1,183.901 4+ Y[pHN2] 15.5
74.964 74.928 910.741 7+ 1,143.388 4+ Y[pN2] 9.3
74.964 74.928 910.741 7+ 1,632.216 3+ Y[pH2N2] 6.6
74.964 74.928 910.741 7+ 1,524.181 3+ Y[pN2] 6.6

Spectra

22560;EThcD;74.670;22556;911.028;Byonic:q-value=0.000101/GPS:MinICScore=133.587
22562;HCD;74.675;22556;911.028;