TG000355

From GPTWiki
Jump to navigation Jump to search
Peptide K.YLGN[H5N4FS2]ATAIFFLPDEGKLQHLENELTHDIITK.F (PE000254)
Sequence YLGNATAIFFLPDEGKLQHLENELTHDIITK
Glycans(s) H5N4FS2 (N4)
Mod(s)
Molecular Weight 5,908.671
Charge 5+
Protein SERPINA1 (P01009)
Spectrum File MS_31_UO1_MARS_MS2_1ug_longn_CE20_std
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction MARS Depleted
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
65.888 65.827 1,179.140 5+ 1,478.390 3+ Y[pH3N2] 26.7
65.888 65.827 1,179.140 5+ 1,424.373 3+ Y[pH2N2] 26.0
65.888 65.827 1,179.140 5+ 1,872.463 2+ Y[pN] 23.5
65.888 65.827 1,179.140 5+ 1,248.644 3+ Y[pN] 22.7
65.888 65.827 1,179.140 5+ 1,370.355 3+ Y[pHN2] 12.5
65.888 65.827 1,179.140 5+ 1,316.337 3+ Y[pN2] 9.5
65.888 65.827 1,179.140 5+ 1,600.101 3+ Y[pH4N3] 8.9
65.888 65.827 1,179.140 5+ 1,546.083 3+ Y[pH3N3] 8.2
65.888 65.827 1,179.140 5+ 1,527.076 3+ Y[pH3N2F]* 6.3

Spectra

19300;EThcD;65.594;19286;1179.538;Byonic:q-value=5.45e-10/GPS:MinICScore=36.755
19302;HCD;65.601;19286;1179.538;
19517;EThcD;66.170;19501;1179.345;Byonic:q-value=3.2e-07/GPS:MinICScore=184.969
19519;HCD;66.175;19501;1179.345;