TG000349

From GPTWiki
Jump to navigation Jump to search
Peptide R.REGDHEFLEVPEAQEDVEATFPVHQPGN[H5N4S2]YSCSYR.T (PE000229)
Sequence REGDHEFLEVPEAQEDVEATFPVHQPGNYSCSYR
Glycans(s) H5N4S2 (N28)
Mod(s) 57.021 (C31)
Molecular Weight 6,214.554
Charge 4+
Protein A1BG (P04217)
Spectrum File MS_31_UO1_MARS_MS2_1ug_longn_CE20_std
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction MARS Depleted
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
39.043 39.095 1,550.147 4+ 1,750.752 3+ Y[pH4N3] 85.8
39.043 39.095 1,550.147 4+ 1,399.295 3+ Y[pN] 25.6
39.043 39.095 1,550.147 4+ 1,575.024 3+ Y[pH2N2] 12.5
39.043 39.095 1,550.147 4+ 1,872.463 3+ Y[pH5N4] 11.4
39.043 39.095 1,550.147 4+ 1,477.373 4+ Y[pH5N4S] 10.3
39.043 39.095 1,550.147 4+ 1,847.784 3+ Y[pH4N3S] 10.3
39.043 39.095 1,550.147 4+ 1,629.041 3+ Y[pH3N2] 7.5
39.043 39.095 1,550.147 4+ 1,642.717 3+ Y[pH2N3] 6.2
39.043 39.095 1,550.147 4+ 1,521.006 3+ Y[pHN2] 5.8

Spectra

10272;EThcD;39.232;10265;1550.649;Byonic:q-value=8.3e-10/GPS:MinICScore=193.889
10274;HCD;39.238;10265;1550.649;