TG000322

From GPTWiki
Jump to navigation Jump to search
Peptide R.EGDHEFLEVPEAQEDVEATFPVHQPGN[H5N4S2]YSCSYR.T (PE000224)
Sequence EGDHEFLEVPEAQEDVEATFPVHQPGNYSCSYR
Glycans(s) H5N4S2 (N27)
Mod(s) 57.021 (C30)
Molecular Weight 6,058.453
Charge 4+
Protein A1BG (P04217)
Spectrum File MS_31_UO1_MARS_MS2_1ug_longn_CE20_std
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction MARS Depleted
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
44.127 44.039 1,511.121 4+ 1,644.701 3+ Y[pH3N3] 21.0
44.127 44.039 1,511.121 4+ 1,347.262 3+ Y[pN] 20.3
44.127 44.039 1,511.121 4+ 1,347.065 4+ Y[pH4N3S] 15.1
44.127 44.039 1,511.121 4+ 1,522.990 3+ Y[pH2N2] 9.2
44.127 44.039 1,511.121 4+ 1,820.429 3+ Y[pH5N4] 6.7
44.127 44.039 1,511.121 4+ 1,577.008 3+ Y[pH3N2] 5.4
44.127 44.039 1,511.121 4+ 1,414.955 3+ Y[pN2] 5.2

Spectra

11854;EThcD;44.204;11849;1511.370;Byonic:q-value=1.39e-10/GPS:MinICScore=750.949
11856;HCD;44.209;11849;1511.370;