TG000316

From GPTWiki
Jump to navigation Jump to search
Peptide R.TEVSSNHVLIYLDKVSN[H5N4FS2]QTLSLFFTVLQDVPVRDLKPAIVK.V (PE000239)
Sequence TEVSSNHVLIYLDKVSNQTLSLFFTVLQDVPVRDLKPAIVK
Glycans(s) H5N4FS2 (N17)
Mod(s)
Molecular Weight 6,994.388
Charge 6+
Protein A2M (P01023)
Spectrum File MS_31_UO1_MARS_MS2_1ug_longn_CE20_std
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction MARS Depleted
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
81.548 81.401 1,163.737 6+ 1,208.164 4+ Y[pN] 31.2
81.548 81.401 1,163.737 6+ 1,339.961 4+ Y[pH2N2] 23.1
81.548 81.401 1,163.737 6+ 1,610.550 3+ Y[pN] 20.9
81.548 81.401 1,163.737 6+ 1,380.474 4+ Y[pH3N2] 17.7
81.548 81.401 1,163.737 6+ 1,376.475 4+ Y[pH2N2F]* 17.2
81.548 81.401 1,163.737 6+ 1,416.988 4+ Y[pH3N2F]* 17.1
81.548 81.401 1,163.737 6+ 1,508.271 4+ Y[pH4N3F] 12.6
81.548 81.401 1,163.737 6+ 1,467.758 4+ Y[pH3N3F] 11.5
81.548 81.401 1,163.737 6+ 1,299.448 4+ Y[pHN2] 11.4
81.548 81.401 1,163.737 6+ 1,206.819 5+ Y[pH4N3F] 11.1
81.548 81.401 1,163.737 6+ 1,431.244 4+ Y[pH3N3] 10.9
81.548 81.401 1,163.737 6+ 1,244.679 4+ Y[pNF]* 9.0
81.548 81.401 1,163.737 6+ 1,177.607 5+ Y[pH4N3] 8.9
81.548 81.401 1,163.737 6+ 1,157.395 4+ Y[p] 8.2
81.548 81.401 1,163.737 6+ 1,145.197 5+ Y[pH3N3] 6.7
81.548 81.401 1,163.737 6+ 1,542.857 3+ Y[p] 6.4
81.548 81.401 1,163.737 6+ 1,659.236 3+ Y[pNF]* 6.3
81.548 81.401 1,163.737 6+ 1,335.962 4+ Y[pHN2F]* 6.0
81.548 81.401 1,163.737 6+ 1,174.408 5+ Y[pH3N3F] 5.9

Spectra

24877;EThcD;81.308;24861;1163.905;Byonic:q-value=2.42e-13/GPS:MinICScore=82.664
24879;HCD;81.314;24861;1163.905;
25041;EThcD;81.778;25031;1163.908;Byonic:q-value=5.29e-12/GPS:MinICScore=50.370
25043;HCD;81.783;25031;1163.908;