TG000314

From GPTWiki
Jump to navigation Jump to search
Peptide R.TEVSSNHVLIYLDKVSN[H6N5S3]QTLSLFFTVLQDVPVRDLKPAIVK.V (PE000252)
Sequence TEVSSNHVLIYLDKVSNQTLSLFFTVLQDVPVRDLKPAIVK
Glycans(s) H6N5S3 (N17)
Mod(s)
Molecular Weight 7,504.558
Charge 6+
Protein A2M (P01023)
Spectrum File MS_31_UO1_MARS_MS2_1ug_longn_CE20_std
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction MARS Depleted
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
85.335 85.636 1,248.766 6+ 1,208.164 4+ Y[pN] 17.5
85.335 85.636 1,248.766 6+ 1,610.550 3+ Y[pN] 15.8
85.335 85.636 1,248.766 6+ 1,471.757 4+ Y[pH4N3] 15.3
85.335 85.636 1,248.766 6+ 1,431.244 4+ Y[pH3N3] 14.4
85.335 85.636 1,248.766 6+ 1,339.961 4+ Y[pH2N2] 14.1
85.335 85.636 1,248.766 6+ 1,250.634 5+ Y[pH5N4] 11.2
85.335 85.636 1,248.766 6+ 1,563.040 4+ Y[pH5N4] 10.1
85.335 85.636 1,248.766 6+ 1,299.448 4+ Y[pHN2] 7.7
85.335 85.636 1,248.766 6+ 1,308.853 5+ Y[pH5N4S] 6.4
85.335 85.636 1,248.766 6+ 1,145.197 5+ Y[pH3N3] 6.2
85.335 85.636 1,248.766 6+ 1,522.527 4+ Y[pH4N4] 5.9

Spectra

26214;EThcD;85.329;26208;1248.772;Byonic:q-value=1.6e-08/GPS:MinICScore=86.783
26216;HCD;85.335;26208;1248.772;