TG000307

From GPTWiki
Jump to navigation Jump to search
Peptide R.TEVSSNHVLIYLDKVSN[H5N4S2]QTLSLFFTVLQDVPVR.D (PE000262)
Sequence TEVSSNHVLIYLDKVSNQTLSLFFTVLQDVPVR
Glycans(s) H5N4S2 (N17)
Mod(s)
Molecular Weight 5,983.787
Charge 4+
Protein A2M (P01023)
Spectrum File MS_31_UO1_MARS_MS2_1ug_longn_CE20_std
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction MARS Depleted
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
89.251 1,492.452 4+ 1,673.826 3+ Y[pH4N3] 31.1
89.251 1,492.452 4+ 1,619.808 3+ Y[pH3N3] 16.9
89.251 1,492.452 4+ 1,983.049 2+ Y[pN] 12.1
89.251 1,492.452 4+ 1,322.369 3+ Y[pN] 10.9
89.251 1,492.452 4+ 1,770.857 3+ Y[pH4N3S] 7.1
89.251 1,492.452 4+ 1,498.097 3+ Y[pH2N2] 6.1
89.251 1,492.452 4+ 1,552.115 3+ Y[pH3N2] 5.3
89.251 1,492.452 4+ 1,795.536 3+ Y[pH5N4] 6.1

Spectra

27373;EThcD;89.133;27368;1492.952;Byonic:q-value=2.16e-09/GPS:MinICScore=83.225
27375;HCD;89.140;27368;1492.952;
27444;EThcD;89.357;27436;1492.702;Byonic:q-value=8.74e-13/GPS:MinICScore=327.744
27446;HCD;89.362;27436;1492.702;