TG000304

From GPTWiki
Jump to navigation Jump to search
Peptide K.QLVLKAPDKNVIFSPLSISTALAFLSLGAHN[H5N4S2]TTLTEILK.G (PE000243)
Sequence QLVLKAPDKNVIFSPLSISTALAFLSLGAHNTTLTEILK
Glycans(s) H5N4S2 (N31)
Mod(s)
Molecular Weight 6,386.144
Charge 6+
Protein SERPINA3 (P01011)
Spectrum File MS_31_UO1_MARS_MS2_1ug_longn_CE20_std
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction MARS Depleted
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
74.964 74.922 1,062.363 6+ 1,456.488 3+ Y[pN] 34.8
74.964 74.922 1,062.363 6+ 1,632.216 3+ Y[pH2N2] 22.3
74.964 74.922 1,062.363 6+ 1,686.234 3+ Y[pH3N2] 19.5
74.964 74.922 1,062.363 6+ 1,224.414 4+ Y[pH2N2] 17.0
74.964 74.922 1,062.363 6+ 1,092.618 4+ Y[pN] 15.3
74.964 74.922 1,062.363 6+ 1,093.375 5+ Y[pH3N4] 12.7
74.964 74.922 1,062.363 6+ 1,578.199 3+ Y[pHN2] 10.8
74.964 74.922 1,062.363 6+ 1,143.388 4+ Y[pN2] 8.0
74.964 74.922 1,062.363 6+ 1,264.927 4+ Y[pH3N2] 6.6
74.964 74.922 1,062.363 6+ 1,524.181 3+ Y[pN2] 7.2
74.964 74.922 1,062.363 6+ 1,183.901 4+ Y[pHN2] 11.3

Spectra

22551;EThcD;74.646;22537;1062.533;Byonic:q-value=2.16e-08/GPS:MinICScore=30.961
22553;HCD;74.651;22537;1062.533;
22744;EThcD;75.203;22738;1062.700;Byonic:q-value=2.8e-08/GPS:MinICScore=89.079
22746;HCD;75.209;22738;1062.700;
22765;EThcD;75.276;22754;1062.533;Byonic:q-value=3.57e-08/GPS:MinICScore=33.306
22767;HCD;75.281;22754;1062.533;