TG000299

From GPTWiki
Jump to navigation Jump to search
Peptide R.TEVSSNHVLIYLDKVSN[H5N4S2]QTLSLFFTVLQDVPVRDLKPAIVK.V (PE000268)
Sequence TEVSSNHVLIYLDKVSNQTLSLFFTVLQDVPVRDLKPAIVK
Glycans(s) H5N4S2 (N17)
Mod(s)
Molecular Weight 6,848.33
Charge 6+
Protein A2M (P01023)
Spectrum File MS_31_UO1_MARS_MS2_1ug_longn_CE20_std
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction MARS Depleted
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
81.422 81.394 1,139.394 6+ 1,208.164 4+ Y[pN] 36.0
81.422 81.394 1,139.394 6+ 1,339.961 4+ Y[pH2N2] 28.0
81.422 81.394 1,139.394 6+ 1,380.474 4+ Y[pH3N2] 26.9
81.422 81.394 1,139.394 6+ 1,610.550 3+ Y[pN] 21.3
81.422 81.394 1,139.394 6+ 1,177.607 5+ Y[pH4N3] 18.9
81.422 81.394 1,139.394 6+ 1,299.448 4+ Y[pHN2] 12.4
81.422 81.394 1,139.394 6+ 1,431.244 4+ Y[pH3N3] 12.3
81.422 81.394 1,139.394 6+ 1,145.197 5+ Y[pH3N3] 11.6
81.422 81.394 1,139.394 6+ 1,367.072 5+ Y[pH5N4S2] 14.2
81.422 81.394 1,139.394 6+ 1,157.395 4+ Y[p] 9.1
81.422 81.394 1,139.394 6+ 1,250.634 5+ Y[pH5N4] 6.7
81.422 81.394 1,139.394 6+ 1,258.934 4+ Y[pN2] 10.1
81.422 81.394 1,139.394 6+ 1,542.857 3+ Y[p] 6.0

Spectra

24688;EThcD;80.778;24674;1139.731;Byonic:q-value=1.64e-09/GPS:MinICScore=81.498
24690;HCD;80.785;24674;1139.731;
24914;EThcD;81.409;24899;1139.562;Byonic:q-value=3.14e-12/GPS:MinICScore=36.018
24916;HCD;81.422;24899;1139.562;
25019;EThcD;81.708;25009;1139.394;Byonic:q-value=3.77e-13/GPS:MinICScore=26.645
25021;HCD;81.713;25009;1139.394;