TG000287

From GPTWiki
Jump to navigation Jump to search
Peptide R.SDHGSSISCQPPAEIPGYLPADTVHLAVEFFN[H6N5S3]LTHLPANLLQGASK.L (PE000271)
Sequence SDHGSSISCQPPAEIPGYLPADTVHLAVEFFNLTHLPANLLQGASK
Glycans(s) H6N5S3 (N32)
Mod(s) 57.021 (C9)
Molecular Weight 7,777.444
Charge 6+
Protein LRG1 (P02750)
Spectrum File MS_31_UO1_MARS_MS2_1ug_longn_CE20_std
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction MARS Depleted
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
83.818 83.711 1,294.249 6+ 1,539.982 4+ Y[pH4N3] 11.3
83.818 83.711 1,294.249 6+ 1,499.469 4+ Y[pH3N3] 7.9
83.818 83.711 1,294.249 6+ 1,631.265 4+ Y[pH5N4] 6.0
83.818 83.711 1,294.249 6+ 1,408.186 4+ Y[pH2N2] 5.2

Spectra

25702;EThcD;83.727;25695;1294.415;Byonic:q-value=1.59e-12/GPS:MinICScore=142.261
25704;HCD;83.733;25695;1294.415;
25762;EThcD;83.899;25749;1294.575;Byonic:q-value=1.16e-10/GPS:MinICScore=360.036
25764;HCD;83.903;25749;1294.575;