TG000283

From GPTWiki
Jump to navigation Jump to search
Peptide K.QLVLKAPDKNVIFSPLSISTALAFLSLGAHN[H5N4S2]TTLTEILK.G (PE000243)
Sequence QLVLKAPDKNVIFSPLSISTALAFLSLGAHNTTLTEILK
Glycans(s) H5N4S2 (N31)
Mod(s)
Molecular Weight 6,386.144
Charge 5+
Protein SERPINA3 (P01011)
Spectrum File MS_31_UO1_MARS_MS2_1ug_longn_CE20_std
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction MARS Depleted
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
74.964 74.932 1,274.635 5+ 1,632.216 3+ Y[pH2N2] 40.2
74.964 74.932 1,274.635 5+ 1,456.488 3+ Y[pN] 39.2
74.964 74.932 1,274.635 5+ 1,686.234 3+ Y[pH3N2] 38.2
74.964 74.932 1,274.635 5+ 1,578.199 3+ Y[pHN2] 13.8
74.964 74.932 1,274.635 5+ 1,807.945 3+ Y[pH4N3] 11.6
74.964 74.932 1,274.635 5+ 1,753.927 3+ Y[pH3N3] 10.1
74.964 74.932 1,274.635 5+ 1,524.181 3+ Y[pN2] 9.8
74.964 74.932 1,274.635 5+ 1,092.618 4+ Y[pN] 8.2
74.964 74.932 1,274.635 5+ 1,093.375 5+ Y[pH3N4] 6.1

Spectra

22658;EThcD;74.959;22645;1274.836;Byonic:q-value=4.05e-15/GPS:MinICScore=19.883
22660;HCD;74.964;22645;1274.836;