TG000274

From GPTWiki
Jump to navigation Jump to search
Peptide R.TEVSSNHVLIYLDKVSN[H5N4FS]QTLSLFFTVLQDVPVR.D (PE000273)
Sequence TEVSSNHVLIYLDKVSNQTLSLFFTVLQDVPVR
Glycans(s) H5N4FS (N17)
Mod(s)
Molecular Weight 5,838.749
Charge 6+
Protein A2M (P01023)
Spectrum File MS_31_UO1_MARS_MS2_1ug_longn_CE20_std
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction MARS Depleted
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
84.200 84.174 971.131 6+ 1,322.369 3+ Y[pN] 19.0
84.200 84.174 971.131 6+ 1,498.097 3+ Y[pH2N2] 7.3
84.200 84.174 971.131 6+ 972.288 5+ Y[pH3N3] 5.8
84.200 84.174 971.131 6+ 1,552.115 3+ Y[pH3N2] 5.8

Spectra

25853;EThcD;84.181;25839;971.132;Byonic:q-value=5.93e-13/GPS:MinICScore=213.768
25854;HCD;84.185;25839;971.132;
25862;EThcD;84.208;25855;971.465;Byonic:q-value=5.31e-12/GPS:MinICScore=135.944
25864;HCD;84.215;25855;971.465;