TG000265

From GPTWiki
Jump to navigation Jump to search
Peptide K.GNPEQTPVLKPEEEAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKN[H5N4S]GSLFAFR.G (PE000225)
Sequence GNPEQTPVLKPEEEAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKNGSLFAFR
Glycans(s) H5N4S (N62)
Mod(s) 57.021 (C49)
Molecular Weight 9,396.351
Charge 8+
Protein VTN (P04004)
Spectrum File MS_31_UO1_MARS_MS2_1ug_longn_CE20_std
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction MARS Depleted
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
36.899 36.973 1,173.302 8+ 1,171.714 7+ Y[pH2N2] 16.9
36.899 36.973 1,173.302 8+ 1,393.840 6+ Y[pH3N2] 12.3
36.899 36.973 1,173.302 8+ 1,223.875 7+ Y[pH3N3] 12.1
36.899 36.973 1,173.302 8+ 1,278.967 6+ Y[pN] 11.9
36.899 36.973 1,173.302 8+ 1,096.401 7+ Y[pN] 5.9
36.899 36.973 1,173.302 8+ 1,534.559 5+ Y[pN] 5.3

Spectra

9557;EThcD;36.892;9556;1173.551;Byonic:q-value=6.05e-05/GPS:MinICScore=264.094
9559;HCD;36.899;9556;1173.551;