TG000249

From GPTWiki
Jump to navigation Jump to search
Peptide R.TEVSSNHVLIYLDKVSN[H5N4FS]QTLSLFFTVLQDVPVRDLKPAIVK.V (PE000250)
Sequence TEVSSNHVLIYLDKVSNQTLSLFFTVLQDVPVRDLKPAIVK
Glycans(s) H5N4FS (N17)
Mod(s)
Molecular Weight 6,703.293
Charge 6+
Protein A2M (P01023)
Spectrum File MS_31_UO1_MARS_MS2_1ug_longn_CE20_std
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction MARS Depleted
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
76.566 1,115.222 6+ 1,208.164 4+ Y[pN] 28.7
76.566 1,115.222 6+ 1,339.961 4+ Y[pH2N2] 20.6
76.566 1,115.222 6+ 1,380.474 4+ Y[pH3N2] 15.3
76.566 1,115.222 6+ 1,610.550 3+ Y[pN] 15.4
76.566 1,115.222 6+ 1,376.475 4+ Y[pH2N2F]* 14.9
76.566 1,115.222 6+ 1,416.988 4+ Y[pH3N2F]* 14.3
76.566 1,115.222 6+ 1,206.819 5+ Y[pH4N3F] 9.3
76.566 1,115.222 6+ 1,299.448 4+ Y[pHN2] 9.7
76.566 1,115.222 6+ 1,508.271 4+ Y[pH4N3F] 8.6
76.566 1,115.222 6+ 1,244.679 4+ Y[pNF]* 8.1
76.566 1,115.222 6+ 1,431.244 4+ Y[pH3N3] 6.6
76.566 1,115.222 6+ 1,157.395 4+ Y[p] 7.9
76.566 1,115.222 6+ 1,467.758 4+ Y[pH3N3F] 7.4
76.566 1,115.222 6+ 1,177.607 5+ Y[pH4N3] 6.5
76.566 1,115.222 6+ 1,174.408 5+ Y[pH3N3F] 5.8
76.566 1,115.222 6+ 1,542.857 3+ Y[p] 5.1
76.566 1,115.222 6+ 1,471.757 4+ Y[pH4N3] 5.6
76.566 1,115.222 6+ 1,258.934 4+ Y[pN2] 5.0

Spectra

22891;EThcD;75.622;22885;1115.553;Byonic:q-value=1.15e-07/GPS:MinICScore=91.132
22893;HCD;75.627;22885;1115.553;
23006;EThcD;75.934;23001;1115.220;Byonic:q-value=3.41e-15/GPS:MinICScore=55.607
23008;HCD;75.940;23001;1115.220;
23234;EThcD;76.572;23223;1115.221;Byonic:q-value=3.75e-13/GPS:MinICScore=68.793
23236;HCD;76.577;23223;1115.221;
23605;EThcD;77.634;23593;1115.555;Byonic:q-value=2.5e-06/GPS:MinICScore=227.731
23607;HCD;77.639;23593;1115.555;