TG000157

From GPTWiki
Jump to navigation Jump to search
Peptide R.TEVSSNHVLIYLDKVSN[H5N4S]QTLSLFFTVLQDVPVRDLKPAIVK.V (PE000245)
Sequence TEVSSNHVLIYLDKVSNQTLSLFFTVLQDVPVRDLKPAIVK
Glycans(s) H5N4S (N17)
Mod(s)
Molecular Weight 6,557.235
Charge 5+
Protein A2M (P01023)
Spectrum File MS_31_UO1_MARS_MS2_1ug_longn_CE20_std
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction MARS Depleted
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
76.738 76.585 1,308.853 5+ 1,471.757 4+ Y[pH4N3] 48.2
76.738 76.585 1,308.853 5+ 1,431.244 4+ Y[pH3N3] 26.5
76.738 76.585 1,308.853 5+ 1,610.550 3+ Y[pN] 23.3
76.738 76.585 1,308.853 5+ 1,250.634 5+ Y[pH5N4] 21.9
76.738 76.585 1,308.853 5+ 1,208.164 4+ Y[pN] 17.3
76.738 76.585 1,308.853 5+ 1,339.961 4+ Y[pH2N2] 11.1
76.738 76.585 1,308.853 5+ 1,840.296 3+ Y[pH3N2] 9.4
76.738 76.585 1,308.853 5+ 1,563.040 4+ Y[pH5N4] 8.0
76.738 76.585 1,308.853 5+ 1,380.474 4+ Y[pH3N2] 7.9
76.738 76.585 1,308.853 5+ 1,786.278 3+ Y[pH2N2] 6.4
76.738 76.585 1,308.853 5+ 1,299.448 4+ Y[pHN2] 6.2
76.738 76.585 1,308.853 5+ 1,542.857 3+ Y[p] 5.7
76.738 76.585 1,308.853 5+ 1,258.934 4+ Y[pN2] 5.6

Spectra

23272;EThcD;76.682;23260;1309.054;Byonic:q-value=1.96e-11/GPS:MinICScore=207.142
23274;HCD;76.688;23260;1309.054;
23291;EThcD;76.734;23278;1309.255;Byonic:q-value=8.84e-12/GPS:MinICScore=122.193
23293;HCD;76.738;23278;1309.255;