TG000142

From GPTWiki
Jump to navigation Jump to search
Peptide R.SDHGSSISCQPPAEIPGYLPADTVHLAVEFFN[H6N5F]LTHLPANLLQGASK.L (PE000345)
Sequence SDHGSSISCQPPAEIPGYLPADTVHLAVEFFNLTHLPANLLQGASK
Glycans(s) H6N5F (N32)
Mod(s) 57.021 (C9)
Molecular Weight 7,050.216
Charge 5+
Protein LRG1 (P02750)
Spectrum File MS_31_UO1_MS2_new_measurement_02
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample Human Serum