TG000101

From GPTWiki
Jump to navigation Jump to search
Peptide K.IITILEEEMN[H5N4]VSVCGLYTYGKPVPGHVTVSICR.K (PE000301)
Sequence IITILEEEMNVSVCGLYTYGKPVPGHVTVSICR
Glycans(s) H5N4 (N10)
Mod(s) 57.021 (C14), 57.021 (C32)
Molecular Weight 5,374.48
Charge 4+
Protein A2M (P01023)
Spectrum File MS_31_UO1_MS2_new_measurement_02
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample Human Serum