TG000069

From GPTWiki
Jump to navigation Jump to search
Peptide K.HLQMDIHIFEPQGISFLETESTFMTNQLVDALTTWQN[H5N4]K.T (PE000358)
Sequence HLQMDIHIFEPQGISFLETESTFMTNQLVDALTTWQNK
Glycans(s) H5N4 (N37)
Mod(s)
Molecular Weight 6,102.754
Charge 5+
Protein ITIH4 (Q14624)
Spectrum File MS_31_UO1_MS2_new_measurement_01
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample Human Serum