TG000039

From GPTWiki
Jump to navigation Jump to search
Peptide K.YTGN[H6N5F]ASALFILPDQDKMEEVEAMLLPETLKR.W (PE000339)
Sequence YTGNASALFILPDQDKMEEVEAMLLPETLKR
Glycans(s) H6N5F (N4)
Mod(s)
Molecular Weight 5,673.561
Charge 4+
Protein SERPINA3 (P01011)
Spectrum File MS_31_UO1_MS2_new_measurement_01
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample Human Serum