TG000004

From GPTWiki
Jump to navigation Jump to search
Peptide K.IVLDPSGSMNIYLVLDGSDSIGASN[H5N4S2]FTGAK.K (PE000102)
Sequence IVLDPSGSMNIYLVLDGSDSIGASNFTGAK
Glycans(s) H5N4S2 (N25)
Mod(s)
Molecular Weight 5,263.289
Charge 4+
Protein CFB (P00751)
Spectrum File MS_35_Frac_plasma_run01_fr10_01
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
79.780 1,312.328 4+ 1,622.801 2+ Y[pN] 37.4
79.780 1,312.328 4+ 1,886.393 2+ Y[pH2N2] 12.8
79.780 1,312.328 4+ 1,967.420 2+ Y[pH3N2] 12.2
79.780 1,312.328 4+ 1,805.367 2+ Y[pHN2] 5.1

Spectra

20329;EThcD;78.255;20317;1312.574;Byonic:q-value=8.42e-05/GPS:MinICScore=116.561
20331;HCD;78.263;20317;1312.574;
20347;EThcD;78.319;20333;1312.829;Byonic:q-value=2.31e-05/GPS:MinICScore=79.033
20348;HCD;78.323;20333;1312.829;
20541;EThcD;78.984;20532;1312.571;Byonic:q-value=0.000397/GPS:MinICScore=123.908
20543;HCD;78.990;20532;1312.571;
20598;EThcD;79.188;20590;1312.321;Byonic:q-value=1.05e-07/GPS:MinICScore=26.662
20600;HCD;79.195;20590;1312.321;
20691;EThcD;79.502;20684;1312.829;Byonic:q-value=3.2e-06/GPS:MinICScore=21.356
20693;HCD;79.508;20684;1312.829;
20853;EThcD;80.045;20845;1312.823;Byonic:q-value=0.000355/GPS:MinICScore=69.574
20855;HCD;80.051;20845;1312.823;
20885;EThcD;80.156;20876;1312.322;Byonic:q-value=0.000542/GPS:MinICScore=151.248
20887;HCD;80.163;20876;1312.322;
20900;EThcD;80.204;20891;1312.568;Byonic:q-value=1.32e-05/GPS:MinICScore=144.638
20902;HCD;80.212;20891;1312.568;
21085;EThcD;80.822;21079;1312.573;Byonic:q-value=5.27e-05/GPS:MinICScore=362.188
21087;HCD;80.828;21079;1312.573;
21315;EThcD;81.593;21309;1312.574;Byonic:q-value=0.000866/GPS:MinICScore=419.214
21317;HCD;81.600;21309;1312.574;