Q9BYF1@N546

From GPTWiki
Jump to navigation Jump to search
Protein ACE2 (Q9BYF1)
Site N546
GlyGen Q9BYF1@N546

Samples (Peptides)

Human ACE2 Protein (17 / 17)

Peptides

 StartPeptideEndGlycanMol. Wt.Trans. GroupsDIA Trans. Groups
PE001769519R.TLYQFQFQEALCQAAKHEGPLHKCDISN[H3N3]STEAGQK.L553H3N35,147.31220
PE001675535K.HEGPLHKCDISN[H3N3]STEAGQK.L553H3N33,220.38220
PE001773519R.TLYQFQFQEALCQAAKHEGPLHKCDISN[H3N3F]STEAGQK.L553H3N3F5,293.37020
PE001680535K.HEGPLHKCDISN[H3N3F]STEAGQK.L553H3N3F3,366.44010
PE001677535K.HEGPLHKCDISN[H3N4F]STEAGQK.L553H3N4F3,569.52030
PE001772519R.TLYQFQFQEALCQAAKHEGPLHKCDISN[H3N4F]STEAGQK.L553H3N4F5,496.45030
PE001666542K.CDISN[H3N4F]STEAGQKLFNMLR.L559H3N4F3,545.52710
PE001775519R.TLYQFQFQEALCQAAKHEGPLHKCDISN[H3N5F]STEAGQK.L553H3N5F5,699.52910
PE001681535K.HEGPLHKCDISN[H3N5F]STEAGQK.L553H3N5F3,772.59910
PE001678535K.HEGPLHKCDISN[H4N3]STEAGQK.L553H4N33,382.43510
PE001771519R.TLYQFQFQEALCQAAKHEGPLHKCDISN[H4N3F]STEAGQK.L553H4N3F5,455.42310
PE001676535K.HEGPLHKCDISN[H4N3F]STEAGQK.L553H4N3F3,528.49320
PE001679535K.HEGPLHKCDISN[H4N4F]STEAGQK.L553H4N4F3,731.57310
PE001780535K.HEGPLHKCDISN[H5N3F]STEAGQK.L553H5N3F3,690.54610
PE001774519R.TLYQFQFQEALCQAAKHEGPLHKCDISN[H5N4F]STEAGQK.L553H5N4F5,820.55510
PE001665542K.CDISN[H5N4FS]STEAGQK.L553H5N4FS3,386.30720
PE001770519R.TLYQFQFQEALCQAAKHEGPLHKCDISN[H5N4FS]STEAGQK.L553H5N4FS6,111.65120