PE002179

From GPTWiki
Jump to navigation Jump to search
Name K.GHDLNEDGLVSWEEYKN[H3N5F]ATYGYVLDDPDPDDGFNYK.Q
Sequence GHDLNEDGLVSWEEYKNATYGYVLDDPDPDDGFNYK
Glycans(s) H3N5F (N17)
Mod(s)
Molecular Weight 5815.427
Norm. RT 88.117
Protein CALU (O43852)

Samples

HEK293 Cells

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00638849.82549.79088.1171,450.3624OrbitrapHEK293 Cells4