PE002174

From GPTWiki
Jump to navigation Jump to search
Name K.TKPREEQYN[H5N3F]STYRVVSVLTVLHQDWLNGKEYK.C
Sequence TKPREEQYNSTYRVVSVLTVLHQDWLNGKEYK
Glycans(s) H5N3F (N9)
Mod(s)
Molecular Weight 5463.561
Norm. RT
Protein IGHG1 (P01857)

Samples

NIST IgG Standard

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00635769.000908.6006QExactiveNIST IgG Standard14
TG00635969.0001,090.1185QExactiveNIST IgG Standard12