PE002034

From GPTWiki
Jump to navigation Jump to search
Name R.IQNILSEKPTVTTVYANN[H8N2]GSVLQGSSVASVYDGK.L
Sequence IQNILSEKPTVTTVYANNGSVLQGSSVASVYDGK
Glycans(s) H8N2 (N18)
Mod(s)
Molecular Weight 5259.407
Norm. RT
Protein PON2 (Q15165)

Samples

DDA Transition Groups